PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy013735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 510aa    MW: 55716.8 Da    PI: 7.6835
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59540031PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.17.6e-28129185259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +DgynWrKYGqK+vkg+ef rsYY+Ct+++C++kk++e+s+ d+++++ +  g+Hnh+
  Ahy013735 129 KDGYNWRKYGQKNVKGNEFIRSYYKCTHPNCQAKKQLEQSN-DGQITDSICIGQHNHP 185
                7***************************************9.***************8 PP

2WRKY104.84.5e-33305363159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ++Dgy+WrKYGqK vkg+ +prsYYrC+s+gCpvkk+ver+++d kvv++tYeg+H+he
  Ahy013735 305 VNDGYRWRKYGQKLVKGNANPRSYYRCSSPGCPVKKHVERASHDSKVVITTYEGQHDHE 363
                58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081120.3123187IPR003657WRKY domain
SuperFamilySSF1182905.75E-23124187IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-24124187IPR003657WRKY domain
SMARTSM007741.9E-30128186IPR003657WRKY domain
PfamPF031062.6E-22129185IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-34292365IPR003657WRKY domain
SuperFamilySSF1182901.57E-28297365IPR003657WRKY domain
PROSITE profilePS5081134.589300365IPR003657WRKY domain
SMARTSM007749.1E-38305364IPR003657WRKY domain
PfamPF031069.2E-26306362IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
XHSALSSPVT VVPMVSSEET ADHNVPYAIP LQRASPHSDI TESQGIHGAE TPSSKQKEET  60
SIPSAVAQNK VKDSDVTASA LQSDRQRSTH IAASVEKLVQ SPDTPFREKR HPSQSGHDSP  120
SIIRERVSKD GYNWRKYGQK NVKGNEFIRS YYKCTHPNCQ AKKQLEQSND GQITDSICIG  180
QHNHPRPQSN ITKPVGPVLP VLEEGLDKPR VANVEVEDKS LNEHASVPQQ MKFSHSLQIT  240
NVPAADLMKA AHSQLTTAND EVHNNDYPDS KRQRIDDSNI EVSVADKSTC ASRVVVQTSS  300
EVDFVNDGYR WRKYGQKLVK GNANPRSYYR CSSPGCPVKK HVERASHDSK VVITTYEGQH  360
DHEIPPGRTV THNAATNAQT TTINGKPGTN SVSNPVSTDT RGSRSNEKVN GNSITKSEAG  420
KSPESKLNGQ QQQKNENAVA KQDYVGANIT CQSNSEDPCR SKSNEQPKDD VETKSEGKNG  480
SPNVVVVHDT PGQEGQLKKQ SASDAEAVQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A7e-38127367176WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166668.10.0PREDICTED: WRKY transcription factor 1-like isoform X1
SwissprotQ9SI375e-84WRKY1_ARATH; WRKY transcription factor 1
TrEMBLV7B9E50.0V7B9E5_PHAVU; Uncharacterized protein
STRINGGLYMA02G47650.11e-176(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.22e-83zinc-dependent activator protein-1